Lineage for d1b8aa2 (1b8a A:104-438)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) 
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) 
Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species) 
Species Pyrococcus kodakaraensis [TaxId:311400] [55698] (1 PDB entry) 
Domain d1b8aa2: 1b8a A:104-438 [40765]
Other proteins in same PDB: d1b8aa1, d1b8ab1
complexed with atp, mn
has additional insertions and/or extensions that are not grouped together
Details for d1b8aa2
PDB Entry: 1b8a (more details), 1.9 Å
PDB Description: aspartyl-trna synthetase
PDB Compounds: (A:) protein (aspartyl-tRNA synthetase)SCOPe Domain Sequences for d1b8aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Pyrococcus kodakaraensis [TaxId: 311400]}
plpldptgkvkaeldtrlnnrfmdlrrpevmaifkirssvfkavrdffhengfieihtpk
iiatateggtelfpmkyfeedaflaespqlykeimmasgldrvyeiapifraeehnttrh
lneawsidsemafiedeeevmsflerlvahainyvrehnakeldilnfeleepklpfprv
sydkaleilgdlgkeipwgedidtegerllgkymmenenaplyflyqypseakpfyimky
dnkpeicrafdleyrgveissggqrehrhdilveqikekglnpesfefylkafrygmpph
ggfglgaerlikqmldlpnirevilfprdrrrltp
SCOPe Domain Coordinates for d1b8aa2:
Click to download the PDB-style file with coordinates for d1b8aa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b8aa2:
- d1b8aa2 first appeared (with stable ids) in SCOP 1.55
- d1b8aa2 appears in SCOPe 2.07
View in 3D
