Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein Phosphopantetheine adenylyltransferase [52398] (6 species) |
Species Escherichia coli [TaxId:562] [52399] (4 PDB entries) |
Domain d1b6ta_: 1b6t A: [31600] complexed with cod, so4 |
PDB Entry: 1b6t (more details), 1.8 Å
SCOPe Domain Sequences for d1b6ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b6ta_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]} kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk ewsfissslvkevarhqgdvthflpenvhqalmakla
Timeline for d1b6ta_: