Lineage for d1b6fa_ (1b6f A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431002Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1431243Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1431244Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 1431254Protein Major tree pollen allergen [55963] (4 species)
  7. 1431265Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (18 PDB entries)
  8. 1431284Domain d1b6fa_: 1b6f A: [41316]

Details for d1b6fa_

PDB Entry: 1b6f (more details)

PDB Description: birch pollen allergen bet v 1
PDB Compounds: (A:) protein (major pollen allergen bet v 1-a)

SCOPe Domain Sequences for d1b6fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6fa_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1 [TaxId: 3505]}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskelgetllravesyllahsdayn

SCOPe Domain Coordinates for d1b6fa_:

Click to download the PDB-style file with coordinates for d1b6fa_.
(The format of our PDB-style files is described here.)

Timeline for d1b6fa_: