Lineage for d1b0aa1 (1b0a A:123-288)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
Protein Methylenetetrahydrofolate dehydrogenase/cyclohydrolase [51894] (3 species)
the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated
Species Escherichia coli [TaxId:562] [51896] (1 PDB entry) 
Domain d1b0aa1: 1b0a A:123-288 [30286]
Other proteins in same PDB: d1b0aa2
has additional insertions and/or extensions that are not grouped together
missing some secondary structures that made up less than one-third of the common domain
Details for d1b0aa1
PDB Entry: 1b0a (more details), 2.56 Å
PDB Description: 5,10, methylene-tetrahydropholate dehydrogenase/cyclohydrolase from e coli.
PDB Compounds: (A:) protein (fold bifunctional protein)SCOPe Domain Sequences for d1b0aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]}
fhpynvgrlcqraprlrpctprgivtllerynidtfglnavvigasnivgrpmsmellla
gctttvthrftknlrhhvenadllivavgkpgfipgdwikegaividvginrlengkvvg
dvvfedaakrasyitpvpggvgpmtvatlientlqacveyhdpqde
SCOPe Domain Coordinates for d1b0aa1:
Click to download the PDB-style file with coordinates for d1b0aa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b0aa1:
- d1b0aa1 first appeared (with stable ids) in SCOP 1.55
- d1b0aa1 appears in SCOPe 2.07
View in 3D
