Lineage for d1b00a_ (1b00 A:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (8 families) 
Family c.23.1.1: CheY-related [52173] (26 proteins) 
Protein PhoB receiver domain [52192] (2 species) 
Species Escherichia coli [TaxId:562] [52193] (1 PDB entry) 
Domain d1b00a_: 1b00 A: [31122]
Details for d1b00a_
PDB Entry: 1b00 (more details), 1.88 Å
PDB Description: phob receiver domain from escherichia coli
PDB Compounds: (A:) phosphate regulon transcriptional regulatory protein phobSCOPe Domain Sequences for d1b00a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b00a_ c.23.1.1 (A:) PhoB receiver domain {Escherichia coli [TaxId: 562]}
arrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsg
iqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmr
ri
SCOPe Domain Coordinates for d1b00a_:
Click to download the PDB-style file with coordinates for d1b00a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b00a_:
- d1b00a_ first appeared (with stable ids) in SCOP 1.55
- d1b00a_ appears in SCOPe 2.03
- d1b00a_ appears in SCOPe 2.05
- d1b00a_ appears in the current release, SCOPe 2.08
View in 3D
