Lineage for d1axth1 (1axt H:1-113)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
Domain d1axth1: 1axt H:1-113 [20305]
Other proteins in same PDB: d1axth2, d1axtl1, d1axtl2
part of catalytic Fab 33F12 with an aldolase activity
Details for d1axth1
PDB Entry: 1axt (more details), 2.15 Å
PDB Description: immune versus natural selection: antibody aldolases with the rates of natural enzymes
PDB Compounds: (H:) immunoglobulin igg2aSCOPe Domain Sequences for d1axth1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axth1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evkleesggglvqpggsmklscvvsgltfsrfwmswvrqspekglewvaeirlksdnyat
hyaesvkgkftisrddsksrlylqmnslrtedtgiyyckiyfysfsywgqgtlvtvsa
SCOPe Domain Coordinates for d1axth1:
Click to download the PDB-style file with coordinates for d1axth1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1axth1:
View in 3D
