Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class phi GST [81367] (3 species) |
Species Maize (Zea mays), type III [TaxId:4577] [52882] (1 PDB entry) |
Domain d1aw9a2: 1aw9 A:2-82 [33030] Other proteins in same PDB: d1aw9a1 complexed with cd |
PDB Entry: 1aw9 (more details), 2.2 Å
SCOPe Domain Sequences for d1aw9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} aplklygmplspnvvrvatvlnekgldfeivpvdlttgahkqpdflalnpfgqipalvdg devlfesrainryiaskyase
Timeline for d1aw9a2: