Lineage for d1aw7a2 (1aw7 A:94-194)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) 
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) 
Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species) Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries) 
Domain d1aw7a2: 1aw7 A:94-194 [37753]
Other proteins in same PDB: d1aw7a1, d1aw7b1, d1aw7c1, d1aw7d1
mutant
Details for d1aw7a2
PDB Entry: 1aw7 (more details), 1.95 Å
PDB Description: q136a mutant of toxic shock syndrome toxin-1 from s. aureus
PDB Compounds: (A:) toxic shock syndrome toxin-1SCOPe Domain Sequences for d1aw7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aw7a2 d.15.6.1 (A:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhaltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein
SCOPe Domain Coordinates for d1aw7a2:
Click to download the PDB-style file with coordinates for d1aw7a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aw7a2:
- d1aw7a2 first appeared (with stable ids) in SCOP 1.55
- d1aw7a2 appears in SCOPe 2.04
- d1aw7a2 appears in SCOPe 2.06
- d1aw7a2 appears in the current release, SCOPe 2.08
View in 3D
