Lineage for d1auqa_ (1auq A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864111Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1864112Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 1864113Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 1864228Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species)
  7. 1864229Species Human (Homo sapiens) [TaxId:9606] [53307] (9 PDB entries)
  8. 1864232Domain d1auqa_: 1auq A: [34137]
    complexed with cd

Details for d1auqa_

PDB Entry: 1auq (more details), 2.3 Å

PDB Description: a1 domain of von willebrand factor
PDB Compounds: (A:) a1 domain of von willebrand factor

SCOPe Domain Sequences for d1auqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auqa_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
disepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavve
yhdgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasri
alllmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvl
ssvdeleqqrdeivsylcdlapeapppt

SCOPe Domain Coordinates for d1auqa_:

Click to download the PDB-style file with coordinates for d1auqa_.
(The format of our PDB-style files is described here.)

Timeline for d1auqa_: