Lineage for d1auoa_ (1auo A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins) 
Protein Carboxylesterase [53548] (2 species) Species Pseudomonas fluorescens [TaxId:294] [53549] (2 PDB entries) 
Domain d1auoa_: 1auo A: [34716]
Details for d1auoa_
PDB Entry: 1auo (more details), 1.8 Å
PDB Description: carboxylesterase from pseudomonas fluorescens
PDB Compounds: (A:) carboxylesteraseSCOPe Domain Sequences for d1auoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]}
mteplilqpakpadacviwlhglgadrydfmpvaealqesllttrfvlpqaptrpvting
gyempswydikamsparsisleelevsakmvtdlieaqkrtgidasriflagfsqggavv
fhtafinwqgplggvialstyaptfgdelelsasqqripalclhgqyddvvqnamgrsaf
ehlksrgvtvtwqeypmghevlpqeihdigawlaarlg
SCOPe Domain Coordinates for d1auoa_:
Click to download the PDB-style file with coordinates for d1auoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1auoa_:
- d1auoa_ first appeared (with stable ids) in SCOP 1.55
- d1auoa_ appears in SCOPe 2.04
- d1auoa_ appears in SCOPe 2.06
- d1auoa_ appears in the current release, SCOPe 2.08
View in 3D
