Lineage for d1auc__ (1auc -)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (16 families) 
Family c.47.1.1: Thioltransferase [52834] (13 proteins) 
Protein Thioredoxin [52835] (12 species) 
Species Human (Homo sapiens) [TaxId:9606] [52842] (18 PDB entries) 
Domain d1auc__: 1auc - [32747]
Details for d1auc__
PDB Entry: 1auc (more details), 2.1 Å
PDB Description: human thioredoxin (oxidized with diamide)
SCOP Domain Sequences for d1auc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auc__ c.47.1.1 (-) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv
SCOP Domain Coordinates for d1auc__:
Click to download the PDB-style file with coordinates for d1auc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1auc__:
- d1auc__ first appeared (with stable ids) in SCOP 1.55
- d1auc__ appears in SCOP 1.69
- d1auc__ is called d1auca_ in SCOP 1.73
- d1auc__ appears in the current release, SCOPe 2.08, called d1auca_
View in 3D