Lineage for d1asha_ (1ash A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1715808Protein Ascaris hemoglobin, domain 1 [46520] (1 species)
  7. 1715809Species Pig roundworm (Ascaris suum) [TaxId:6253] [46521] (1 PDB entry)
  8. 1715810Domain d1asha_: 1ash A: [15622]
    complexed with hem, oxy

Details for d1asha_

PDB Entry: 1ash (more details), 2.15 Å

PDB Description: the structure of ascaris hemoglobin domain i at 2.2 angstroms resolution: molecular features of oxygen avidity
PDB Compounds: (A:) hemoglobin (oxy)

SCOPe Domain Sequences for d1asha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}
anktrelcmkslehakvdtsnearqdgidlykhmfenypplrkyfksreeytaedvqndp
ffakqgqkillachvlcatyddretfnaytrelldrhardhvhmppevwtdfwklfeeyl
gkkttldeptkqawheigrefakeink

SCOPe Domain Coordinates for d1asha_:

Click to download the PDB-style file with coordinates for d1asha_.
(The format of our PDB-style files is described here.)

Timeline for d1asha_: