Lineage for d1ar1b2 (1ar1 B:1-107)
- Root: SCOPe 2.08
Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) 
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
two antiparallel transmembrane helicesSuperfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) 
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) 
Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species) Species Paracoccus denitrificans [TaxId:266] [81456] (4 PDB entries) 
Domain d1ar1b2: 1ar1 B:1-107 [43619]
Other proteins in same PDB: d1ar1a_, d1ar1b1, d1ar1c_, d1ar1d_
complexed with ca, cu, hea, lda, mg
Details for d1ar1b2
PDB Entry: 1ar1 (more details), 2.7 Å
PDB Description: Structure at 2.7 Angstrom Resolution of the Paracoccus Denitrificans two-subunit Cytochrome C Oxidase Complexed with an Antibody Fv Fragment
PDB Compounds: (B:) cytochrome c oxidaseSCOPe Domain Sequences for d1ar1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ar1b2 f.17.2.1 (B:1-107) Bacterial aa3 type cytochrome c oxidase subunit II {Paracoccus denitrificans [TaxId: 266]}
qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfvlyiitavtifvcllllicivrf
nrranpvparfthntpieviwtlvpvlilvaigafslpilfrsqemp
SCOPe Domain Coordinates for d1ar1b2:
Click to download the PDB-style file with coordinates for d1ar1b2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ar1b2:
- d1ar1b2 first appeared (with stable ids) in SCOP 1.55
- d1ar1b2 appears in SCOPe 2.07
View in 3D
