SCOPe 2.04: Domain d1aqwa1: 1aqw A:77-209

Lineage for d1aqwa1 (1aqw A:77-209)

Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds)
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
Protein Class pi GST [81347] (4 species)
Species Human (Homo sapiens) [TaxId:9606] [47619] (52 PDB entries)
Domain d1aqwa1: 1aqw A:77-209 [17517]
Other proteins in same PDB: d1aqwa2, d1aqwb2, d1aqwc2, d1aqwd2
complexed with gsh, mes

Details for d1aqwa1

PDB Entry: 1aqw (more details), 1.8 Å

PDB Description: glutathione s-transferase in complex with glutathione

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1aqwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqwa1 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d1aqwa1:

Click to download the PDB-style file with coordinates for d1aqwa1.
(The format of our PDB-style files is described here.)

Timeline for d1aqwa1: