Lineage for d1aqkh1 (1aqk H:1-123)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries)
Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
Domain d1aqkh1: 1aqk H:1-123 [20193]
Other proteins in same PDB: d1aqkh2, d1aqkl1, d1aqkl2
part of Fab B7-15A2
Details for d1aqkh1
PDB Entry: 1aqk (more details), 1.84 Å
PDB Description: three-dimensional structure of a human fab with high affinity for tetanus toxoid
PDB Compounds: (H:) fab b7-15a2SCOPe Domain Sequences for d1aqkh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqkh1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvesgggvvqpgrslrlscaasgftfnnyaihwvrqapgkglewvafisydgsknyy
adsvkgrftisrdnskntlflqmnslrpedtaiyycarvlfqqlvlyapfdiwgqgtmvt
vss
SCOPe Domain Coordinates for d1aqkh1:
Click to download the PDB-style file with coordinates for d1aqkh1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aqkh1:
- d1aqkh1 first appeared (with stable ids) in SCOP 1.55
- d1aqkh1 appears in SCOPe 2.05
- d1aqkh1 appears in SCOPe 2.07
- d1aqkh1 appears in the current release, SCOPe 2.08
View in 3D
