Lineage for d1aq7a_ (1aq7 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1319321Protein Trypsin(ogen) [50515] (9 species)
  7. 1319339Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
    Uniprot P00760
  8. 1319709Domain d1aq7a_: 1aq7 A: [25874]

Details for d1aq7a_

PDB Entry: 1aq7 (more details), 2.2 Å

PDB Description: trypsin with inhibitor aeruginosin 98-b
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1aq7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aq7a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d1aq7a_:

Click to download the PDB-style file with coordinates for d1aq7a_.
(The format of our PDB-style files is described here.)

Timeline for d1aq7a_: