Lineage for d1allb_ (1all B:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
binds a bilin chromophore
automatically mapped to Pfam PF00502
Protein Allophycocyanin beta subunit [88957] (3 species) Species Spirulina platensis [TaxId:118562] [88958] (1 PDB entry) 
Domain d1allb_: 1all B: [15648]
Other proteins in same PDB: d1alla_
complexed with cyc
Details for d1allb_
PDB Entry: 1all (more details), 2.3 Å
PDB Description: allophycocyanin
PDB Compounds: (B:) allophycocyaninSCOPe Domain Sequences for d1allb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1allb_ a.1.1.3 (B:) Allophycocyanin beta subunit {Spirulina platensis [TaxId: 118562]}
mqdaitsvinssdvqgkyldasaiqklkayfatgelrvraattisanaanivkeavaksl
lysdvtrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
vpigatvqaiqamkevtaglvgggagkemgiyfdyicsgls
SCOPe Domain Coordinates for d1allb_:
Click to download the PDB-style file with coordinates for d1allb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1allb_:
- d1allb_ first appeared (with stable ids) in SCOP 1.55
- d1allb_ appears in SCOPe 2.04
- d1allb_ appears in SCOPe 2.06
- d1allb_ appears in the current release, SCOPe 2.08
View in 3D
