Lineage for d1af0a1 (1af0 A:247-471)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
superhelix turns are made of parallel beta-strands and (short) turns
Superfamily b.80.7: beta-Roll [51120] (2 families) 
superhelix turns are made of two short strands eachFamily b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)
duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns
this is a repeat family; one repeat unit is 1go7 P:374-356 found in domainProtein Metalloprotease [51122] (4 species)
The catalytic N-terminal domain belong to the "zincin" superfamily
Species Serratia marcescens [TaxId:615] [51124] (4 PDB entries)
serralysin
Domain d1af0a1: 1af0 A:247-471 [28017]
Other proteins in same PDB: d1af0a2
complexed with 0z9, ca, zn
Details for d1af0a1
PDB Entry: 1af0 (more details), 1.8 Å
PDB Description: serratia protease in complex with inhibitor
PDB Compounds: (A:) serratia proteaseSCOPe Domain Sequences for d1af0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1af0a1 b.80.7.1 (A:247-471) Metalloprotease {Serratia marcescens [TaxId: 615]}
ganlstrtgdtvygfnsntgrdflsttsnsqkvifaawdaggndtfdfsgytanqrinln
eksfsdvgglkgnvsiaagvtienaiggsgndvivgnaannvlkggagndvlfggggade
lwggagkdifvfsaasdsapgasdwirdfqkgidkidlsffdkeansssfihfvdhfsgt
ageallsynassnvtdlsvnigghqapdflvkivgqvdvatdfiv
SCOPe Domain Coordinates for d1af0a1:
Click to download the PDB-style file with coordinates for d1af0a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1af0a1:
- d1af0a1 first appeared (with stable ids) in SCOP 1.55
- d1af0a1 appears in SCOPe 2.03
- d1af0a1 appears in SCOPe 2.05
- d1af0a1 appears in the current release, SCOPe 2.08
View in 3D
