Lineage for d1adza_ (1adz A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1241938Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 1241939Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 1241940Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 1242114Protein Tissue factor pathway inhibitor [57368] (1 species)
  7. 1242115Species Human (Homo sapiens) [TaxId:9606] [57369] (4 PDB entries)
  8. 1242121Domain d1adza_: 1adz A: [44542]
    second kunitz domain

Details for d1adza_

PDB Entry: 1adz (more details)

PDB Description: the solution structure of the second kunitz domain of tissue factor pathway inhibitor, nmr, 30 structures
PDB Compounds: (A:) tissue factor pathway inhibitor

SCOPe Domain Sequences for d1adza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adza_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]}
dykddddklkpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleec
knicedgpngf

SCOPe Domain Coordinates for d1adza_:

Click to download the PDB-style file with coordinates for d1adza_.
(The format of our PDB-style files is described here.)

Timeline for d1adza_: