Lineage for d1abwa1 (1abw A:1-142)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 902058Protein Hemoglobin, alpha-chain [46486] (22 species)
  7. 902171Species Human (Homo sapiens) [TaxId:9606] [46487] (200 PDB entries)
    Uniprot P69905 P01922 P01934 P01935
  8. 902302Domain d1abwa1: 1abw A:1-142 [15288]
    Other proteins in same PDB: d1abwb_, d1abwd_
    recombinant hemoglobin; two alpha subunits fused in a single chain
    complexed with hem, leu, met

Details for d1abwa1

PDB Entry: 1abw (more details), 2 Å

PDB Description: deoxy rhb1.1 (recombinant hemoglobin)
PDB Compounds: (A:) hemoglobin-based blood substitute

SCOPe Domain Sequences for d1abwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abwa1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyrg

SCOPe Domain Coordinates for d1abwa1:

Click to download the PDB-style file with coordinates for d1abwa1.
(The format of our PDB-style files is described here.)

Timeline for d1abwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1abwa2