Lineage for d1ab2a_ (1ab2 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2571842Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2572190Protein Proto-oncogen tyrosine kinase [55573] (1 species)
  7. 2572191Species Human (Homo sapiens) [TaxId:9606] [55574] (2 PDB entries)
  8. 2572193Domain d1ab2a_: 1ab2 A: [40506]

Details for d1ab2a_

PDB Entry: 1ab2 (more details)

PDB Description: three-dimensional solution structure of the src homology 2 domain of c-abl
PDB Compounds: (A:) c-abl tyrosine kinase sh2 domain

SCOPe Domain Sequences for d1ab2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ab2a_ d.93.1.1 (A:) Proto-oncogen tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
gsgnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyri
ntasdgklyvssesrfntlaelvhhhstvadglittlhypapkrgihrd

SCOPe Domain Coordinates for d1ab2a_:

Click to download the PDB-style file with coordinates for d1ab2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ab2a_: