Lineage for d1aapa_ (1aap A:)
- Root: SCOPe 2.06
Class g: Small proteins [56992] (94 folds) 
Fold g.8: BPTI-like [57361] (1 superfamily)
disulfide-rich alpha+beta foldSuperfamily g.8.1: BPTI-like [57362] (4 families) 
Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) 
Protein Alzheimer's amyloid B-protein precursor, APPI [57370] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57371] (4 PDB entries) 
Domain d1aapa_: 1aap A: [44543]
Details for d1aapa_
PDB Entry: 1aap (more details), 1.5 Å
PDB Description: x-ray crystal structure of the protease inhibitor domain of alzheimer's amyloid beta-protein precursor
PDB Compounds: (A:) alzheimer's disease amyloid a4 proteinSCOPe Domain Sequences for d1aapa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]}
vrevcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg
SCOPe Domain Coordinates for d1aapa_:
Click to download the PDB-style file with coordinates for d1aapa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aapa_:
- d1aapa_ first appeared (with stable ids) in SCOP 1.55
- d1aapa_ appears in SCOPe 2.05
- d1aapa_ appears in SCOPe 2.07
- d1aapa_ appears in the current release, SCOPe 2.08
View in 3D
