Lineage for d1a8pa2 (1a8p A:101-258)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) 
binds NADP differently than classical Rossmann-fold
N-terminal FAD-linked domain contains (6,10) barrelFamily c.25.1.1: Reductases [52344] (5 proteins) 
Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species) 
Species Azotobacter vinelandii [TaxId:354] [52352] (1 PDB entry) 
Domain d1a8pa2: 1a8p A:101-258 [31544]
Other proteins in same PDB: d1a8pa1
complexed with fad
Details for d1a8pa2
PDB Entry: 1a8p (more details), 2 Å
PDB Description: ferredoxin reductase from azotobacter vinelandii
PDB Compounds: (A:) nadph:ferredoxin oxidoreductaseSCOPe Domain Sequences for d1a8pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8pa2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Azotobacter vinelandii [TaxId: 354]}
tsdllpgkhlymlstgtglapfmsliqdpevyerfekvvlihgvrqvnelayqqfitehl
pqseyfgeavkekliyyptvtresfhnqgrltdlmrsgklfediglppinpqddramicg
spsmldescevldgfglkisprmgepgdylierafvek
SCOPe Domain Coordinates for d1a8pa2:
Click to download the PDB-style file with coordinates for d1a8pa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a8pa2:
- d1a8pa2 first appeared (with stable ids) in SCOP 1.55, called d1a8p_2
- d1a8pa2 appears in SCOPe 2.04
- d1a8pa2 appears in SCOPe 2.06
- d1a8pa2 appears in the current release, SCOPe 2.08
View in 3D
