Lineage for d1a8pa1 (1a8p A:2-100)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
barrel, closed; n=6, S=10; greek-keySuperfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) 
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
coupled with a NADP-binding domain of alpha/beta class
Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species) 
Species Azotobacter vinelandii [TaxId:354] [50422] (1 PDB entry) 
Domain d1a8pa1: 1a8p A:2-100 [25654]
Other proteins in same PDB: d1a8pa2
complexed with fad
Details for d1a8pa1
PDB Entry: 1a8p (more details), 2 Å
PDB Description: ferredoxin reductase from azotobacter vinelandii
PDB Compounds: (A:) nadph:ferredoxin oxidoreductaseSCOPe Domain Sequences for d1a8pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]}
snlnvervlsvhhwndtlfsfkttrnpslrfengqfvmiglevdgrplmraysiaspnye
ehleffsikvqngpltsrlqhlkegdelmvsrkptgtlv
SCOPe Domain Coordinates for d1a8pa1:
Click to download the PDB-style file with coordinates for d1a8pa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a8pa1:
- d1a8pa1 first appeared (with stable ids) in SCOP 1.55, called d1a8p_1
- d1a8pa1 appears in SCOPe 2.04
- d1a8pa1 appears in SCOPe 2.06
- d1a8pa1 appears in the current release, SCOPe 2.08
View in 3D
