Lineage for d1a88a_ (1a88 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1869905Family c.69.1.12: Haloperoxidase [53531] (8 proteins)
    automatically mapped to Pfam PF12697
    automatically mapped to Pfam PF00561
  6. 1869925Protein Chloroperoxidase L [53538] (1 species)
  7. 1869926Species Streptomyces lividans [TaxId:1916] [53539] (1 PDB entry)
  8. 1869927Domain d1a88a_: 1a88 A: [34707]

Details for d1a88a_

PDB Entry: 1a88 (more details), 1.9 Å

PDB Description: chloroperoxidase l
PDB Compounds: (A:) chloroperoxidase l

SCOPe Domain Sequences for d1a88a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]}
gtvttsdgtnifykdwgprdglpvvfhhgwplsaddwdnqmlfflshgyrviahdrrghg
rsdqpstghdmdtyaadvaaltealdlrgavhighstgggevaryvaraepgrvakavlv
savppvmvksdtnpdglplevfdefraalaanraqfyidvpsgpfygfnregatvsqgli
dhwwlqgmmgaanahyeciaafsetdftddlkridvpvlvahgtddqvvpyadaapksae
llanatlksyeglphgmlsthpevlnpdllafvks

SCOPe Domain Coordinates for d1a88a_:

Click to download the PDB-style file with coordinates for d1a88a_.
(The format of our PDB-style files is described here.)

Timeline for d1a88a_: