Lineage for d1a6ga_ (1a6g A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978189Protein Myoglobin [46469] (10 species)
  7. 1978334Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (267 PDB entries)
    Uniprot P02185
  8. 1978344Domain d1a6ga_: 1a6g A: [15021]
    complexed with cmo, hem, so4

Details for d1a6ga_

PDB Entry: 1a6g (more details), 1.15 Å

PDB Description: carbonmonoxy-myoglobin, atomic resolution
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1a6ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6ga_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gnfgadaqgamnkalelfrkdiaakykelgy

SCOPe Domain Coordinates for d1a6ga_:

Click to download the PDB-style file with coordinates for d1a6ga_.
(The format of our PDB-style files is described here.)

Timeline for d1a6ga_: