Lineage for d1a47a3 (1a47 A:407-495)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 808141Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 808142Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 808143Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 808290Protein Cyclodextrin glycosyltransferase [51018] (6 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 808354Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [51023] (2 PDB entries)
  8. 808356Domain d1a47a3: 1a47 A:407-495 [27760]
    Other proteins in same PDB: d1a47a1, d1a47a2, d1a47a4
    complexed with ca, cyl, glc, gld, gte

Details for d1a47a3

PDB Entry: 1a47 (more details), 2.56 Å

PDB Description: cgtase from thermoanaerobacterium thermosulfurigenes em1 in complex with a maltohexaose inhibitor
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOP Domain Sequences for d1a47a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a47a3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
gttqqrwinndvyiyerkfgnnvalvainrnlstsynitglytalpagtytdvlggllng
nsisvasdgsvtpftlsagevavwqyvss

SCOP Domain Coordinates for d1a47a3:

Click to download the PDB-style file with coordinates for d1a47a3.
(The format of our PDB-style files is described here.)

Timeline for d1a47a3: