Lineage for d1a2wa_ (1a2w A:)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.5: RNase A-like [54075] (1 superfamily)
contains long curved beta-sheet and 3 helicesSuperfamily d.5.1: RNase A-like [54076] (2 families) 
can be classified as disulfide-richFamily d.5.1.1: Ribonuclease A-like [54077] (9 proteins) Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species) Species Cow (Bos taurus) [TaxId:9913] [54079] (143 PDB entries) 
Domain d1a2wa_: 1a2w A: [37248]
3d domain-swapped dimer
complexed with cl, so4
Details for d1a2wa_
PDB Entry: 1a2w (more details), 2.1 Å
PDB Description: crystal structure of a 3d domain-swapped dimer of bovine pancreatic ribonuclease a
PDB Compounds: (A:) ribonuclease aSCOPe Domain Sequences for d1a2wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2wa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv
SCOPe Domain Coordinates for d1a2wa_:
Click to download the PDB-style file with coordinates for d1a2wa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a2wa_:
- d1a2wa_ first appeared (with stable ids) in SCOP 1.55
- d1a2wa_ appears in SCOP 1.75
- d1a2wa_ appears in SCOPe 2.02
- d1a2wa_ appears in the current release, SCOPe 2.08
View in 3D
