Lineage for d1a21a2 (1a21 A:107-208)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families) 
Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
Pfam PF00041
Protein Extracellular region of human tissue factor [49267] (2 species)
tandem of fibronectin type III domains
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (1 PDB entry) 
Domain d1a21a2: 1a21 A:107-208 [21968]
Details for d1a21a2
PDB Entry: 1a21 (more details), 2.35 Å
PDB Description: tissue factor (tf) from rabbit
PDB Compounds: (A:) tissue factorSCOPe Domain Sequences for d1a21a2:
Sequence, based on SEQRES records: (download)
>d1a21a2 b.1.2.1 (A:107-208) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtklnvtvqdartlvrrngtflslravfgkdlnytlyywrasstgkkta
ttntneflidvdkgenycfsvqavipsrkrkqrspesltect
Sequence, based on observed residues (ATOM records): (download)
>d1a21a2 b.1.2.1 (A:107-208) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtklnvtvqdartlvtflslravfgkdlnytlyywrkktattntnefli
dvdkgenycfsvqavipsrkrkqrspesltect
SCOPe Domain Coordinates for d1a21a2:
Click to download the PDB-style file with coordinates for d1a21a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a21a2:
View in 3D
