Lineage for d1a21a1 (1a21 A:4-106)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
Pfam PF00041
Protein Extracellular region of human tissue factor [49267] (2 species)
tandem of fibronectin type III domains
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries) 
Domain d1a21a1: 1a21 A:4-106 [21967]
Details for d1a21a1
PDB Entry: 1a21 (more details), 2.35 Å
PDB Description: tissue factor (tf) from rabbit
PDB Compounds: (A:) tissue factorSCOP Domain Sequences for d1a21a1:
Sequence, based on SEQRES records: (download)
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tgraynltwkstnfktilewepksidhvytvqistrlenwkskcfltaetecdltdevvk
dvgqtymarvlsyparngnttgfpeeppfrnspeftpyldtnl
Sequence, based on observed residues (ATOM records): (download)
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tgraynltwkstnfktilewepksidhvytvqistrlenwkskcfltaetecdltdevvk
dvgqtymarvlsyparnttgfpeeppfrnspeftpyldtnl
SCOP Domain Coordinates for d1a21a1:
Click to download the PDB-style file with coordinates for d1a21a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a21a1:
- d1a21a1 first appeared (with stable ids) in SCOP 1.55
- d1a21a1 appears in SCOP 1.73
- d1a21a1 appears in SCOPe 2.01
- d1a21a1 appears in the current release, SCOPe 2.08
View in 3D
