Lineage for d1a21a1 (1a21 A:4-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761786Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 2761861Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (1 PDB entry)
  8. 2761862Domain d1a21a1: 1a21 A:4-106 [21967]

Details for d1a21a1

PDB Entry: 1a21 (more details), 2.35 Å

PDB Description: tissue factor (tf) from rabbit
PDB Compounds: (A:) tissue factor

SCOPe Domain Sequences for d1a21a1:

Sequence, based on SEQRES records: (download)

>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tgraynltwkstnfktilewepksidhvytvqistrlenwkskcfltaetecdltdevvk
dvgqtymarvlsyparngnttgfpeeppfrnspeftpyldtnl

Sequence, based on observed residues (ATOM records): (download)

>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tgraynltwkstnfktilewepksidhvytvqistrlenwkskcfltaetecdltdevvk
dvgqtymarvlsyparnttgfpeeppfrnspeftpyldtnl

SCOPe Domain Coordinates for d1a21a1:

Click to download the PDB-style file with coordinates for d1a21a1.
(The format of our PDB-style files is described here.)

Timeline for d1a21a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a21a2