Lineage for d1a0ha1 (1a0h A:164-270)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033279Protein Meizothrombin [57450] (2 species)
  7. 3033280Species Cow (Bos taurus) [TaxId:9913] [57451] (2 PDB entries)
  8. 3033282Domain d1a0ha1: 1a0h A:164-270 [44655]
    Other proteins in same PDB: d1a0h.1, d1a0h.2
    complexed with 0g6

Details for d1a0ha1

PDB Entry: 1a0h (more details), 3.2 Å

PDB Description: the x-ray crystal structure of ppack-meizothrombin desf1: kringle/thrombin and carbohydrate/kringle/thrombin interactions and location of the linker chain
PDB Compounds: (A:) meizothrombin

SCOPe Domain Sequences for d1a0ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0ha1 g.14.1.1 (A:164-270) Meizothrombin {Cow (Bos taurus) [TaxId: 9913]}
splletcvpdrgreyrgrlavtthgsrclawsseqakalskdqdfnpavplaenfcrnpd
gdeegawcyvadqpgdfeycdlnyceepvdgdlgdrlgedpdpdaaieg

SCOPe Domain Coordinates for d1a0ha1:

Click to download the PDB-style file with coordinates for d1a0ha1.
(The format of our PDB-style files is described here.)

Timeline for d1a0ha1:

3033282
d1a0ha1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1a0h.1