Lineage for d1a04a1 (1a04 A:150-216)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) 
binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins)
contains additional, fourth helix in the C-terminal extension
Protein Nitrate/nitrite response regulator (NarL) [46901] (1 species) Species Escherichia coli [TaxId:562] [46902] (5 PDB entries) 
Domain d1a04a1: 1a04 A:150-216 [16234]
Other proteins in same PDB: d1a04a2, d1a04b2
Details for d1a04a1
PDB Entry: 1a04 (more details), 2.2 Å
PDB Description: the structure of the nitrate/nitrite response regulator protein narl in the monoclinic c2 crystal form
PDB Compounds: (A:) nitrate/nitrite response regulator protein narlSCOPe Domain Sequences for d1a04a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]}
erdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavw
vhqerif
SCOPe Domain Coordinates for d1a04a1:
Click to download the PDB-style file with coordinates for d1a04a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a04a1:
- d1a04a1 first appeared (with stable ids) in SCOP 1.55
- d1a04a1 appears in SCOPe 2.02
- d1a04a1 appears in SCOPe 2.04
- d1a04a1 appears in the current release, SCOPe 2.08
View in 3D
