Lineage for d1a04a1 (1a04 A:150-216)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695233Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2695270Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins)
    contains additional, fourth helix in the C-terminal extension
  6. 2695279Protein Nitrate/nitrite response regulator (NarL) [46901] (1 species)
  7. 2695280Species Escherichia coli [TaxId:562] [46902] (5 PDB entries)
  8. 2695281Domain d1a04a1: 1a04 A:150-216 [16234]
    Other proteins in same PDB: d1a04a2, d1a04b2

Details for d1a04a1

PDB Entry: 1a04 (more details), 2.2 Å

PDB Description: the structure of the nitrate/nitrite response regulator protein narl in the monoclinic c2 crystal form
PDB Compounds: (A:) nitrate/nitrite response regulator protein narl

SCOPe Domain Sequences for d1a04a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]}
erdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavw
vhqerif

SCOPe Domain Coordinates for d1a04a1:

Click to download the PDB-style file with coordinates for d1a04a1.
(The format of our PDB-style files is described here.)

Timeline for d1a04a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a04a2