PDB entry 9rub

View 9rub on RCSB PDB site
Description: crystal structure of activated ribulose-1,5-bisphosphate carboxylase complexed with its substrate, ribulose-1,5-bisphosphate
Deposited on 1990-11-28, released 1993-01-15
The last revision prior to the SCOP 1.59 freeze date was dated 1995-01-15, with a file datestamp of 1995-01-19.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.199
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >9rubA (A:)
    dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttd
    dftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveya
    kmhdfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeach
    afwlggdfikndepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeii
    argeyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskr
    gytafvhckmarlqgasgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmk
    actpiisggmnalrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdgv
    pvldyarehkelarafesfpgdadqiypgwrkalgvedt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >9rubB (B:)
    dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttd
    dftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveya
    kmhdfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeach
    afwlggdfikndepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeii
    argeyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskr
    gytafvhckmarlqgasgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmk
    actpiisggmnalrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdgv
    pvldyarehkelarafesfpgdadqiypgwrkalgved