PDB entry 9rub

View 9rub on RCSB PDB site
Description: crystal structure of activated ribulose-1,5-bisphosphate carboxylase complexed with its substrate, ribulose-1,5-bisphosphate
Class: lyase(carbon-carbon)
Keywords: lyase(carbon-carbon)
Deposited on 1990-11-28, released 1993-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose-1,5-bisphosphate carboxylase
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04718
      • conflict (90)
    Domains in SCOPe 2.07: d9ruba1, d9ruba2
  • Chain 'B':
    Compound: ribulose-1,5-bisphosphate carboxylase
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04718
      • conflict (90)
    Domains in SCOPe 2.07: d9rubb1, d9rubb2
  • Heterogens: RUB, MG, FMT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >9rubA (A:)
    mdqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevctt
    ddftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdvey
    akmhdfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeac
    hafwlggdfikndepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfei
    iargeyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqsk
    rgytafvhckmarlqgasgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggm
    kactpiisggmnalrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdg
    vpvldyarehkelarafesfpgdadqiypgwrkalgvedtrsalpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >9rubA (A:)
    dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttd
    dftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveya
    kmhdfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeach
    afwlggdfikndepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeii
    argeyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskr
    gytafvhckmarlqgasgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmk
    actpiisggmnalrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdgv
    pvldyarehkelarafesfpgdadqiypgwrkalgvedt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >9rubB (B:)
    mdqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevctt
    ddftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdvey
    akmhdfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeac
    hafwlggdfikndepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfei
    iargeyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqsk
    rgytafvhckmarlqgasgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggm
    kactpiisggmnalrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdg
    vpvldyarehkelarafesfpgdadqiypgwrkalgvedtrsalpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >9rubB (B:)
    dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttd
    dftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveya
    kmhdfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeach
    afwlggdfikndepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeii
    argeyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskr
    gytafvhckmarlqgasgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmk
    actpiisggmnalrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdgv
    pvldyarehkelarafesfpgdadqiypgwrkalgved