PDB entry 9ldt

View 9ldt on RCSB PDB site
Description:
Deposited on 1991-11-26, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.233
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d9ldta1, d9ldta2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d9ldtb1, d9ldtb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >9ldtA (A:)
    atlkdqlihnllkeehvphnkitvvgvgavgmacaisilmkeladeialvdvmedklkge
    mmdlqhgslflrtpkivsgkdynvtansrlvvitagarqqegesrlnlvqrnvnifkfii
    pnivkyspnckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwilgehgdssvpvwsgvnvagvslknlhpelgtdadkehwkavhkevvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikenvflsvpcilgqngis
    dvvkvtltpeeeahlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >9ldtB (B:)
    atlkdqlihnllkeehvphnkitvvgvgavgmacaisilmkeladeialvdvmedklkge
    mmdlqhgslflrtpkivsgkdynvtansrlvvitagarqqegesrlnlvqrnvnifkfii
    pnivkyspnckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwilgehgdssvpvwsgvnvagvslknlhpelgtdadkehwkavhkevvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikenvflsvpcilgqngis
    dvvkvtltpeeeahlkksadtlwgiqkelqf