PDB entry 8rxn

View 8rxn on RCSB PDB site
Description: refinement of rubredoxin from desulfovibrio vulgaris at 1.0 angstroms with and without restraints
Class: electron transport(iron)
Keywords: electron transport(iron)
Deposited on 1991-08-26, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.147
AEROSPACI score: 1.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rubredoxin
  Species: Desulfovibrio vulgaris [TaxId:881]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00269 (0-51)
  Domains in SCOPe 2.06: d8rxna_
• Heterogens: FE, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >8rxnA (A:)
  mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa