PDB entry 8ruc

View 8ruc on RCSB PDB site
Description: activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate
Deposited on 1996-02-22, released 1996-08-01
The last revision prior to the SCOP 1.55 freeze date was dated 1996-08-01, with a file datestamp of 1996-08-02.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.211
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8rucA (A:)
    asvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8rucC (C:)
    asvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8rucE (E:)
    asvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8rucG (G:)
    asvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8rucI (I:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8rucJ (J:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8rucK (K:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8rucL (L:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy