PDB entry 8ruc

View 8ruc on RCSB PDB site
Description: activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate
Class: lyase (carbon-carbon)
Keywords: photosynthesis, carbon dioxide fixation, photorespiration, lyase, oxidoreductase, monooxygenase, chloroplast, lyase (carbon-carbon)
Deposited on 1996-02-22, released 1996-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.211
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875 (Start-474)
      • conflict (200)
    Domains in SCOPe 2.07: d8ruca1, d8ruca2
  • Chain 'C':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875 (Start-474)
      • conflict (200)
    Domains in SCOPe 2.07: d8rucc1, d8rucc2
  • Chain 'E':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875 (Start-474)
      • conflict (200)
    Domains in SCOPe 2.07: d8ruce1, d8ruce2
  • Chain 'G':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875 (Start-474)
      • conflict (200)
    Domains in SCOPe 2.07: d8rucg1, d8rucg2
  • Chain 'I':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d8ruci_
  • Chain 'J':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d8rucj_
  • Chain 'K':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d8ruck_
  • Chain 'L':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d8rucl_
  • Heterogens: MG, CAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >8rucA (A:)
    mspqtetkasvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >8rucA (A:)
    asvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >8rucC (C:)
    mspqtetkasvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >8rucC (C:)
    asvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >8rucE (E:)
    mspqtetkasvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >8rucE (E:)
    asvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >8rucG (G:)
    mspqtetkasvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >8rucG (G:)
    asvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8rucI (I:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8rucJ (J:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8rucK (K:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8rucL (L:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy