PDB entry 8ldh

View 8ldh on RCSB PDB site
Description:
Deposited on 1988-01-04, released 1989-07-12
The last revision prior to the SCOP 1.55 freeze date was dated 1989-07-12, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.191
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d8ldh_1, d8ldh_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8ldh_ (-)
    atlkdklighlatsqeprsynkitvvgvgavgmacaisilmkdladevalvdvmedklkg
    emmdlqhgslflhtakivsgkdysvsagsklvvitagarqqegesrlnlvqrnvnifkfi
    ipnivkhspdciilvvsnpvdvltyvawklsglpmhriigsgcnldsarfrylmgerlgv
    hscschgwvigehgdsvpsvwsgmnvasiklhpldgtnkdkqdwkklhkdvvdsayevik
    lkgytswaiglsvadlaetimknlcrvhpvstmvkdfygikdnvflslpcvlndhgisni
    vkmklkpneeqqlqksattlwdiqkdlkf