PDB entry 8hvp

View 8hvp on RCSB PDB site
Description: structure at 2.5-angstroms resolution of chemically synthesized human immunodeficiency virus type 1 protease complexed with a hydroxyethylene*-based inhibitor
Deposited on 1990-10-26, released 1993-10-31
The last revision prior to the SCOP 1.71 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.138
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d8hvpa_
  • Chain 'B':
    Domains in SCOP 1.71: d8hvpb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >8hvpA (A:)
pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveixghkaigtvlvgptpvniigrnlltqigxtlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >8hvpB (B:)
pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveixghkaigtvlvgptpvniigrnlltqigxtlnf