PDB entry 8hvp

View 8hvp on RCSB PDB site
Description: structure at 2.5-angstroms resolution of chemically synthesized human immunodeficiency virus type 1 protease complexed with a hydroxyethylene*-based inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: acid proteinase, hydrolase-hydrolase inhibitor complex
Deposited on 1990-10-26, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • conflict (66)
      • conflict (94)
    Domains in SCOPe 2.08: d8hvpa_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • conflict (66)
      • conflict (94)
    Domains in SCOPe 2.08: d8hvpb_
  • Chain 'I':
    Compound: inhibitor val-ser-gln-asn-leu-psi(ch(oh)-ch2)-val-ile-val (u-85548e)
    Database cross-references and differences (RAF-indexed):
    • PDB 8HVP (0-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >8hvpA (A:)
pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >8hvpB (B:)
pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf

  • Chain 'I':
    No sequence available.