PDB entry 8abp

View 8abp on RCSB PDB site
Description: sugar-binding and crystallographic studies of an arabinose-binding protein mutant (met108leu) which exhibits enhanced affinity and altered specificity
Class: binding proteins
Keywords: binding proteins
Deposited on 1991-04-25, released 1991-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.175
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-arabinose-binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02924 (Start-305)
      • conflict (107)
    Domains in SCOPe 2.06: d8abpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >8abpA (A:)
    enlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakg
    fvictpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmlaatkigerqgqe
    lykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndip
    gafdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsel
    skaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelek
    kglggk
    

    Sequence, based on observed residues (ATOM records): (download)
    >8abpA (A:)
    nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
    victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmlaatkigerqgqel
    ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
    afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
    kaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
    glggk