PDB entry 821p

View 821p on RCSB PDB site
Description: three-dimensional structures and properties of a transforming and a nontransforming glycine-12 mutant of p21h-ras
Class: oncoprotein
Keywords: oncoprotein
Deposited on 1993-03-29, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.22
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: c-h-ras p21 protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01112 (0-165)
    • engineered mutation (11)
  Domains in SCOPe 2.06: d821pa_
• Heterogens: MG, GNP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >821pA (A:)
  mteyklvvvgapgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
  qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
  aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh