PDB entry 7rxn

View 7rxn on RCSB PDB site
Description: structure of rubredoxin from desulfovibrio vulgaris at 1.5 a resolution
Class: electron transfer(iron-sulfur protein)
Keywords: electron transfer(iron-sulfur protein)
Deposited on 1990-05-11, released 1991-07-15
The last revision prior to the SCOP 1.73 freeze date was dated 1993-01-15, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.098
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Desulfovibrio vulgaris
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d7rxna_
  • Heterogens: FE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7rxnA (A:)
    mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa