PDB entry 7pti

View 7pti on RCSB PDB site
Description: structural effects induced by removal of a disulfide bridge. the x-ray structure of the c30a(slash)c51a mutant of basic pancreatic trypsin inhibitor at 1.6 angstroms
Class: proteinase inhibitor (trypsin)
Keywords: proteinase inhibitor (trypsin)
Deposited on 1990-03-08, released 1991-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.17
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • conflict (29)
      • conflict (50)
    Domains in SCOPe 2.07: d7ptia_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7ptiA (A:)
    rpdfcleppytgpckariiryfynakaglaqtfvyggcrakrnnfksaedamrtcgga