PDB entry 7odc

View 7odc on RCSB PDB site
Description: crystal structure ornithine decarboxylase from mouse, truncated 37 residues from the c-terminus, to 1.6 angstrom resolution
Class: lyase
Keywords: pyridoxal-5'-phosphate, plp, group IV decarboxylase, polyamines, parasitical, chemotherapy target, ornithine, putrescine, a/b-barrel, obligate, lyase
Deposited on 1999-03-03, released 1999-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.199
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ornithine decarboxylase)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7odca1, d7odca2
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7odcA (A:)
    mssftkdefdchildegftakdildqkinevsssddkdafyvadlgdilkkhlrwlkalp
    rvtpfyavkcndsraivstlaaigtgfdcaskteiqlvqglgvpaerviyanpckqvsqi
    kyaasngvqmmtfdseielmkvarahpkaklvlriatddskavcrlsvkfgatlktsrll
    lerakelnidvigvsfhvgsgctdpdtfvqavsdarcvfdmatevgfsmhlldigggfpg
    sedtklkfeeitsvinpaldkyfpsdsgvriiaepgryyvasaftlavniiakktvwkeq
    pgsddedesneqtfmyyvndgvygsfncilydhahvkallqkrpkpdekyysssiwgptc
    dgldrivercnlpemhvgdwmlfenmgaytvaaastfngfqrpniyyvmsrpmwqlmkqi
    qshg
    

    Sequence, based on observed residues (ATOM records): (download)
    >7odcA (A:)
    ssftkdefdchildegftakdildqkindkdafyvadlgdilkkhlrwlkalprvtpfya
    vkcndsraivstlaaigtgfdcaskteiqlvqglgvpaerviyanpckqvsqikyaasng
    vqmmtfdseielmkvarahpkaklvlriatkfgatlktsrlllerakelnidvigvsfhv
    gsgctdpdtfvqavsdarcvfdmatevgfsmhlldigggfpgsedtklkfeeitsvinpa
    ldkyfpsdsgvriiaepgryyvasaftlavniiakktvweqtfmyyvndgvygsfncily
    dhahvkallqkrpkpdekyysssiwgptcdgldrivercnlpemhvgdwmlfenmgaytv
    aaastfngfqrpniyyvmsrpmwqlmk