SCOPe 2.08: Structural Classification of Proteins

PDB entry 7me0

View 7me0 on RCSB PDB site
Description: Cryo-EM structure of SARS-CoV-2 NSP15 NendoU at pH 6.0
Class: viral protein, hydrolase
Keywords: nsp15, sars-cov-2, nendoU, coronavirus, covid-19, VIRAL PROTEIN, HYDROLASE
Deposited on 2021-04-06, released 2021-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-14, with a file datestamp of 2021-04-09.
Experiment type: EM
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Uridylate-specific endoribonuclease
Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
Gene: rep, 1a-1b
Database cross-references and differences (RAF-indexed):
- Uniprot P0DTD1 (27-End)
  - expression tag (25-26)
Domains in SCOPe 2.08: d7me0a1, d7me0a2, d7me0a3
Chain 'B':
Compound: Uridylate-specific endoribonuclease
Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
Gene: rep, 1a-1b
Database cross-references and differences (RAF-indexed):
- Uniprot P0DTD1 (27-End)
  - expression tag (25-26)
Domains in SCOPe 2.08: d7me0b1, d7me0b2, d7me0b3
Chain 'C':
Compound: Uridylate-specific endoribonuclease
Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
Gene: rep, 1a-1b
Database cross-references and differences (RAF-indexed):
- Uniprot P0DTD1 (27-End)
  - expression tag (25-26)
Domains in SCOPe 2.08: d7me0c1, d7me0c2, d7me0c3
Chain 'D':
Compound: Uridylate-specific endoribonuclease
Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
Gene: rep, 1a-1b
Database cross-references and differences (RAF-indexed):
- Uniprot P0DTD1 (27-End)
  - expression tag (25-26)
Domains in SCOPe 2.08: d7me0d1, d7me0d2, d7me0d3
Chain 'E':
Compound: Uridylate-specific endoribonuclease
Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
Gene: rep, 1a-1b
Database cross-references and differences (RAF-indexed):
- Uniprot P0DTD1 (27-End)
  - expression tag (25-26)
Domains in SCOPe 2.08: d7me0e1, d7me0e2, d7me0e3
Chain 'F':
Compound: Uridylate-specific endoribonuclease
Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
Gene: rep, 1a-1b
Database cross-references and differences (RAF-indexed):
- Uniprot P0DTD1 (27-End)
  - expression tag (25-26)
Domains in SCOPe 2.08: d7me0f1, d7me0f2, d7me0f3

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>7me0A (A:)
mkhhhhhhpmsdydipttenlyfqgamslenvafnvvnkghfdgqqgevpvsiinntvyt
kvdgvdvelfenkttlpvnvafelwakrnikpvpevkilnnlgvdiaantviwdykrdap
ahistigvcsmtdiakkpteticapltvffdgrvdgqvdlfrnarngvlitegsvkglqp
svgpkqaslngvtligeavktqfnyykkvdgvvqqlpetyftqsrnlqefkprsqmeidf
lelamdefieryklegyafehivygdfshsqlgglhlliglakrfkespfeledfipmds
tvknyfitdaqtgsskcvcsvidlllddfveiiksqdlsvvskvvkvtidyteisfmlwc
kdghvetfypklq