PDB entry 7l9u

View 7l9u on RCSB PDB site
Description: Crystal Structure of S-adenosylmethionine-dependent methyltransferase UmaA from Mycobacterium tuberculosis in complex with a 12-mer PEG
Class: transferase
Keywords: SSGCID, S-adenosylmethionine-dependent methyltransferase, SAM-dependent methyltransferase, UmaA, Mycobacterium tuberculosis, short-chain fatty acid modification, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2021-01-05, released 2021-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-adenosylmethionine-dependent methyltransferase UmaA
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: umaA, Rv0469, LH57_02505
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7l9ua_
  • Heterogens: 12P, EDO, NO3, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7l9uA (A:)
    mahhhhhhmtelrpfyeesqsiydvsdeffslfldptmaytcayferedmtleeaqnakf
    dlaldklhlepgmtlldigcgwggglqraienydvnvigitlsrnqfeyskaklakipte
    rsvqvrlqgwdeftdkvdrivsigafeafkmeryaaffersydilpddgrmllhtiltyt
    qkqmhemgvkvtmsdvrfmkfigeeifpggqlpaqedifkfaqaadfsvekvqllqqhya
    rtlniwaanleankdraialqseeiynkymhyltgcehffrkgisnvgqftltk
    

    Sequence, based on observed residues (ATOM records): (download)
    >7l9uA (A:)
    elrpfyeesqsiydvsdeffslfldptmaytcayferedmtleeaqnakfdlaldklhle
    pgmtlldigcgwggglqraienydvnvigitlsrnqfeyskaklakiptersvqvrlqgw
    deftdkvdrivsigafeafkmeryaaffersydilpddgrmllhtiltytqkqmhemgvk
    vtmsdvrfmkfigeeiggqlpaqedifkfaqaadfsvekvqllqqhyartlniwaanlea
    nkdraialqseeiynkymhyltgcehffrkgisnvgqftltk